- Recombinant Arabidopsis thaliana UPF0136 membrane protein At2g26240 (At2g26240)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1099075
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,108 Da
- E Coli or Yeast
- 1-108
- T1D16_12, T1D16.12
- UPF0136 membrane protein At2g26240 (At2g26240)
Sequence
MDSSLSQKFTLAYASLLGVGGLMGYLKRGSKISLVAGGGSAALFYYVYTELPGNPVLASSIGIVGSAALTGMMGSRYLRTRKVVPAGLVSVVSLVMTGAYLHGLIRSS